Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348
  1. Avatar for pvc78 51. pvc78 Lv 1 17 pts. 9,642
  2. Avatar for Idiotboy 52. Idiotboy Lv 1 16 pts. 9,637
  3. Avatar for Azukay 53. Azukay Lv 1 15 pts. 9,633
  4. Avatar for caglar 54. caglar Lv 1 14 pts. 9,633
  5. Avatar for jobo0502 55. jobo0502 Lv 1 14 pts. 9,633
  6. Avatar for Merf 56. Merf Lv 1 13 pts. 9,631
  7. Avatar for fiendish_ghoul 57. fiendish_ghoul Lv 1 13 pts. 9,625
  8. Avatar for Cagdason 58. Cagdason Lv 1 12 pts. 9,622
  9. Avatar for dcrwheeler 59. dcrwheeler Lv 1 12 pts. 9,617
  10. Avatar for Vincera 60. Vincera Lv 1 11 pts. 9,615

Comments