Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689
  1. Avatar for pvc78 51. pvc78 Lv 1 17 pts. 9,642
  2. Avatar for Idiotboy 52. Idiotboy Lv 1 16 pts. 9,637
  3. Avatar for Azukay 53. Azukay Lv 1 15 pts. 9,633
  4. Avatar for caglar 54. caglar Lv 1 14 pts. 9,633
  5. Avatar for jobo0502 55. jobo0502 Lv 1 14 pts. 9,633
  6. Avatar for Merf 56. Merf Lv 1 13 pts. 9,631
  7. Avatar for fiendish_ghoul 57. fiendish_ghoul Lv 1 13 pts. 9,625
  8. Avatar for Cagdason 58. Cagdason Lv 1 12 pts. 9,622
  9. Avatar for dcrwheeler 59. dcrwheeler Lv 1 12 pts. 9,617
  10. Avatar for Vincera 60. Vincera Lv 1 11 pts. 9,615

Comments