Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,622
  2. Avatar for Russian team 12. Russian team 1 pt. 9,496
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 9,227
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,136
  5. Avatar for freefolder 15. freefolder 1 pt. 9,096
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,096
  7. Avatar for Deleted group 17. Deleted group pts. 9,066
  8. Avatar for Deleted group 18. Deleted group pts. 8,348
  1. Avatar for cobaltteal 81. cobaltteal Lv 1 4 pts. 9,515
  2. Avatar for Vinara 82. Vinara Lv 1 4 pts. 9,506
  3. Avatar for ComputerMage 83. ComputerMage Lv 1 4 pts. 9,496
  4. Avatar for Auntecedent 84. Auntecedent Lv 1 3 pts. 9,471
  5. Avatar for micheldeweerd 85. micheldeweerd Lv 1 3 pts. 9,463
  6. Avatar for rabamino12358 86. rabamino12358 Lv 1 3 pts. 9,461
  7. Avatar for thewholeblahthing 87. thewholeblahthing Lv 1 3 pts. 9,461
  8. Avatar for frostschutz 88. frostschutz Lv 1 3 pts. 9,460
  9. Avatar for ppp6 89. ppp6 Lv 1 3 pts. 9,460
  10. Avatar for ViJay7019 90. ViJay7019 Lv 1 2 pts. 9,447

Comments