Placeholder image of a protein
Icon representing a puzzle

1468: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,795
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,790
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 9,790
  4. Avatar for Go Science 4. Go Science 38 pts. 9,774
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 9,772
  6. Avatar for Contenders 6. Contenders 18 pts. 9,768
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,743
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,735
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,696
  10. Avatar for Deleted group 10. Deleted group pts. 9,689

  1. Avatar for cobaltteal 81. cobaltteal Lv 1 4 pts. 9,515
  2. Avatar for Vinara 82. Vinara Lv 1 4 pts. 9,506
  3. Avatar for ComputerMage 83. ComputerMage Lv 1 4 pts. 9,496
  4. Avatar for Auntecedent 84. Auntecedent Lv 1 3 pts. 9,471
  5. Avatar for micheldeweerd 85. micheldeweerd Lv 1 3 pts. 9,463
  6. Avatar for rabamino12358 86. rabamino12358 Lv 1 3 pts. 9,461
  7. Avatar for thewholeblahthing 87. thewholeblahthing Lv 1 3 pts. 9,461
  8. Avatar for frostschutz 88. frostschutz Lv 1 3 pts. 9,460
  9. Avatar for ppp6 89. ppp6 Lv 1 3 pts. 9,460
  10. Avatar for ViJay7019 90. ViJay7019 Lv 1 2 pts. 9,447

Comments