Placeholder image of a protein
Icon representing a puzzle

1469: Unsolved De-novo Freestyle 123

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
January 11, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EFRLTSGRNDDVREYLKQRLKEGTTVEVRIDNGSDKQIEEIIRDLEEQTRRDGGELDVEKRNGDVRIEIR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,550
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 9,504
  3. Avatar for Go Science 3. Go Science 58 pts. 9,398
  4. Avatar for Contenders 4. Contenders 43 pts. 9,364
  5. Avatar for Beta Folders 5. Beta Folders 31 pts. 9,313
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 9,299
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 9,267
  8. Avatar for Void Crushers 8. Void Crushers 11 pts. 9,218
  9. Avatar for Russian team 9. Russian team 7 pts. 9,217
  10. Avatar for Deleted group 10. Deleted group pts. 9,023

  1. Avatar for tamanrasset 81. tamanrasset Lv 1 4 pts. 8,611
  2. Avatar for ikalvet 82. ikalvet Lv 1 4 pts. 8,608
  3. Avatar for sciencewalker 83. sciencewalker Lv 1 4 pts. 8,604
  4. Avatar for sharondipity 84. sharondipity Lv 1 3 pts. 8,602
  5. Avatar for Arne Heessels 85. Arne Heessels Lv 1 3 pts. 8,594
  6. Avatar for Cagdason 86. Cagdason Lv 1 3 pts. 8,590
  7. Avatar for MagicQuokka 87. MagicQuokka Lv 1 3 pts. 8,582
  8. Avatar for abiogenesis 88. abiogenesis Lv 1 3 pts. 8,571
  9. Avatar for multaq 89. multaq Lv 1 3 pts. 8,552
  10. Avatar for mitarcher 90. mitarcher Lv 1 2 pts. 8,516

Comments