1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 8 years ago

Summary

• Created: February 07, 2018
• Expires: February 14, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

• 1. Beta Folders 100 pts. 10,050
• 2. Anthropic Dreams 76 pts. 10,022
• 3. Go Science 56 pts. 10,013
• 4. Contenders 41 pts. 10,005
• 5. Marvin's bunch 29 pts. 9,992
• 6. Void Crushers 20 pts. 9,937
• 7. Gargleblasters 14 pts. 9,893
• 8. L'Alliance Francophone 9 pts. 9,877
• 9. HMT heritage 6 pts. 9,796
• 10. Eastern Prehistoric Force 4 pts. 9,560

Top soloists

• 31. drjr 37 pts. 9,808
• 32. O Seki To 35 pts. 9,796
• 33. YeshuaLives 34 pts. 9,792
• 34. fiendish_ghoul 33 pts. 9,791
• 35. toshiue 32 pts. 9,785
• 36. jausmh 30 pts. 9,773
• 37. pvc78 29 pts. 9,771
• 38. isaksson 28 pts. 9,771
• 39. Museka 27 pts. 9,767
• 40. andrewxc 26 pts. 9,765