Placeholder image of a protein
Icon representing a puzzle

1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 07, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,050
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,022
  3. Avatar for Go Science 3. Go Science 56 pts. 10,013
  4. Avatar for Contenders 4. Contenders 41 pts. 10,005
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 9,992
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,937
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 9,893
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 9,877
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 9,796
  10. Avatar for Eastern Prehistoric Force 10. Eastern Prehistoric Force 4 pts. 9,560
  1. Avatar for khalan.ysatis 61. khalan.ysatis Lv 1 11 pts. 9,662
  2. Avatar for dbuske 62. dbuske Lv 1 10 pts. 9,646
  3. Avatar for jamiexq 63. jamiexq Lv 1 10 pts. 9,618
  4. Avatar for alwen 64. alwen Lv 1 9 pts. 9,616
  5. Avatar for ManVsYard 65. ManVsYard Lv 1 9 pts. 9,604
  6. Avatar for Deleted player 66. Deleted player pts. 9,596
  7. Avatar for katling 67. katling Lv 1 8 pts. 9,579
  8. Avatar for wuhongzei 68. wuhongzei Lv 1 8 pts. 9,560
  9. Avatar for SKSbell 69. SKSbell Lv 1 7 pts. 9,547
  10. Avatar for whongzei 70. whongzei Lv 1 7 pts. 9,546

Comments