1480: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since about 8 years ago

Summary

• Created: February 07, 2018
• Expires: February 14, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

• 1. Beta Folders 100 pts. 10,050
• 2. Anthropic Dreams 76 pts. 10,022
• 3. Go Science 56 pts. 10,013
• 4. Contenders 41 pts. 10,005
• 5. Marvin's bunch 29 pts. 9,992
• 6. Void Crushers 20 pts. 9,937
• 7. Gargleblasters 14 pts. 9,893
• 8. L'Alliance Francophone 9 pts. 9,877
• 9. HMT heritage 6 pts. 9,796
• 10. Eastern Prehistoric Force 4 pts. 9,560

Top soloists

• 51. Vinara 17 pts. 9,699
• 52. alcor29 16 pts. 9,696
• 53. jobo0502 15 pts. 9,691
• 54. WBarme1234 14 pts. 9,687
• 55. dizzywings 14 pts. 9,687
• 56. Maerlyn138 13 pts. 9,685
• 57. bcre8tvv 13 pts. 9,678
• 58. TastyMunchies 12 pts. 9,677
• 59. manu8170 12 pts. 9,673
• 60. Glen B 11 pts. 9,665