Placeholder image of a protein
Icon representing a puzzle

1483: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,116
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,954
  3. Avatar for Go Science 3. Go Science 41 pts. 9,944
  4. Avatar for Void Crushers 4. Void Crushers 24 pts. 9,932
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 14 pts. 9,927
  6. Avatar for Marvin's bunch 6. Marvin's bunch 7 pts. 9,839
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 9,823
  8. Avatar for Contenders 8. Contenders 2 pts. 9,762
  9. Avatar for Russian team 9. Russian team 1 pt. 9,402
  10. Avatar for freefolder 10. freefolder 1 pt. 9,048
  1. Avatar for multaq 91. multaq Lv 1 2 pts. 9,154
  2. Avatar for pfirth 92. pfirth Lv 1 2 pts. 9,147
  3. Avatar for roman madala 93. roman madala Lv 1 1 pt. 9,125
  4. Avatar for rabamino12358 94. rabamino12358 Lv 1 1 pt. 9,122
  5. Avatar for Threeoak 95. Threeoak Lv 1 1 pt. 9,110
  6. Avatar for harvardman 96. harvardman Lv 1 1 pt. 9,106
  7. Avatar for alwen 97. alwen Lv 1 1 pt. 9,106
  8. Avatar for martinf 98. martinf Lv 1 1 pt. 9,104
  9. Avatar for demeter900 99. demeter900 Lv 1 1 pt. 9,097
  10. Avatar for Arne Heessels 100. Arne Heessels Lv 1 1 pt. 9,088

Comments