Placeholder image of a protein
Icon representing a puzzle

1484: Unsolved De-novo Freestyle 126

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 15, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRIELRDDNGRYEIHVDDNGDRIEINIDNGDVQIRSHDSNEDRQRKIEEFLRRQDTHLEEMVRRLLKELEKESK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,573
  2. Avatar for Gargleblasters 2. Gargleblasters 65 pts. 9,525
  3. Avatar for Go Science 3. Go Science 41 pts. 9,509
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 9,465
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 9,438
  6. Avatar for Contenders 6. Contenders 7 pts. 9,344
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 9,308
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 9,269
  9. Avatar for Russian team 9. Russian team 1 pt. 9,231
  10. Avatar for freefolder 10. freefolder 1 pt. 8,956
  1. Avatar for drumpeter18yrs9yrs 61. drumpeter18yrs9yrs Lv 1 10 pts. 8,984
  2. Avatar for Altercomp 62. Altercomp Lv 1 9 pts. 8,956
  3. Avatar for hansvandenhof 63. hansvandenhof Lv 1 9 pts. 8,950
  4. Avatar for Deleted player 64. Deleted player pts. 8,932
  5. Avatar for Marvelz 65. Marvelz Lv 1 8 pts. 8,931
  6. Avatar for weitzen 66. weitzen Lv 1 8 pts. 8,930
  7. Avatar for Jim Fraser 67. Jim Fraser Lv 1 7 pts. 8,903
  8. Avatar for fishercat 68. fishercat Lv 1 7 pts. 8,892
  9. Avatar for Glen B 69. Glen B Lv 1 6 pts. 8,857
  10. Avatar for robgee 70. robgee Lv 1 6 pts. 8,831

Comments