1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Summary

• Created: February 20, 2018
• Expires: February 28, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

• 1. Beta Folders 100 pts. 10,202
• 2. Go Science 71 pts. 10,115
• 3. Gargleblasters 49 pts. 10,077
• 4. Marvin's bunch 33 pts. 10,015
• 5. Void Crushers 22 pts. 9,953
• 6. Anthropic Dreams 14 pts. 9,949
• 7. HMT heritage 8 pts. 9,872
• 8. Contenders 5 pts. 9,796
• 9. L'Alliance Francophone 3 pts. 9,795
• 10. Eastern Prehistoric Force 2 pts. 9,603

Top soloists

• 11. eusair 71 pts. 9,987
• 12. Bruno Kestemont 68 pts. 9,973
• 13. Timo van der Laan 66 pts. 9,953
• 14. Deleted player pts. 9,942
• 15. Galaxie 61 pts. 9,921
• 16. jausmh 59 pts. 9,900
• 17. jeff101 57 pts. 9,897
• 18. pauldunn 55 pts. 9,888
• 19. mberna00 53 pts. 9,876
• 20. O Seki To 51 pts. 9,872