Placeholder image of a protein
Icon representing a puzzle

1486: Revisiting Puzzle 165: Rosetta Model 15

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,202
  2. Avatar for Go Science 2. Go Science 71 pts. 10,115
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 10,077
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 10,015
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,953
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,949
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,872
  8. Avatar for Contenders 8. Contenders 5 pts. 9,796
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,795
  10. Avatar for Eastern Prehistoric Force 10. Eastern Prehistoric Force 2 pts. 9,603
  1. Avatar for may of rose 131. may of rose Lv 1 1 pt. 8,862
  2. Avatar for gabrielcgs 132. gabrielcgs Lv 1 1 pt. 8,846
  3. Avatar for aspadistra 133. aspadistra Lv 1 1 pt. 8,833
  4. Avatar for Gahmeir 134. Gahmeir Lv 1 1 pt. 8,802
  5. Avatar for SaintNick 135. SaintNick Lv 1 1 pt. 8,801
  6. Avatar for strelokXxX 136. strelokXxX Lv 1 1 pt. 8,784
  7. Avatar for fdmendoza 137. fdmendoza Lv 1 1 pt. 8,592
  8. Avatar for aj50 138. aj50 Lv 1 1 pt. 8,553
  9. Avatar for mitup 139. mitup Lv 1 1 pt. 8,528
  10. Avatar for aaronsun 140. aaronsun Lv 1 1 pt. 8,507

Comments