Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 5,622
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 5,060
  3. Avatar for Russian team 13. Russian team 1 pt. 0
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 0
  1. Avatar for Arne Heessels 101. Arne Heessels Lv 1 1 pt. 7,606
  2. Avatar for fdmendoza 102. fdmendoza Lv 1 1 pt. 7,593
  3. Avatar for senor pit 103. senor pit Lv 1 1 pt. 7,509
  4. Avatar for Anton Trikshev 104. Anton Trikshev Lv 1 1 pt. 7,484
  5. Avatar for Psych0Active 105. Psych0Active Lv 1 1 pt. 7,459
  6. Avatar for gstelle 106. gstelle Lv 1 1 pt. 7,439
  7. Avatar for antibot215 107. antibot215 Lv 1 1 pt. 7,403
  8. Avatar for andrewxc 108. andrewxc Lv 1 1 pt. 7,337
  9. Avatar for Fabius42 109. Fabius42 Lv 1 1 pt. 7,241
  10. Avatar for 01010011111 110. 01010011111 Lv 1 1 pt. 7,167

Comments