Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 1 pt. 6,239
  1. Avatar for Arne Heessels 101. Arne Heessels Lv 1 1 pt. 7,606
  2. Avatar for fdmendoza 102. fdmendoza Lv 1 1 pt. 7,593
  3. Avatar for senor pit 103. senor pit Lv 1 1 pt. 7,509
  4. Avatar for Anton Trikshev 104. Anton Trikshev Lv 1 1 pt. 7,484
  5. Avatar for Psych0Active 105. Psych0Active Lv 1 1 pt. 7,459
  6. Avatar for gstelle 106. gstelle Lv 1 1 pt. 7,439
  7. Avatar for antibot215 107. antibot215 Lv 1 1 pt. 7,403
  8. Avatar for andrewxc 108. andrewxc Lv 1 1 pt. 7,337
  9. Avatar for Fabius42 109. Fabius42 Lv 1 1 pt. 7,241
  10. Avatar for 01010011111 110. 01010011111 Lv 1 1 pt. 7,167

Comments