Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 5,622
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 5,060
  3. Avatar for Russian team 13. Russian team 1 pt. 0
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 0
  1. Avatar for alwen 41. alwen Lv 1 22 pts. 8,763
  2. Avatar for jeff101 42. jeff101 Lv 1 22 pts. 8,759
  3. Avatar for Fat Tony 43. Fat Tony Lv 1 21 pts. 8,754
  4. Avatar for diamonddays 44. diamonddays Lv 1 20 pts. 8,724
  5. Avatar for Tehnologik1 45. Tehnologik1 Lv 1 19 pts. 8,708
  6. Avatar for Altercomp 46. Altercomp Lv 1 18 pts. 8,708
  7. Avatar for WBarme1234 47. WBarme1234 Lv 1 17 pts. 8,670
  8. Avatar for ManVsYard 48. ManVsYard Lv 1 16 pts. 8,640
  9. Avatar for Deleted player 49. Deleted player pts. 8,639
  10. Avatar for caglar 50. caglar Lv 1 15 pts. 8,634

Comments