Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 1 pt. 6,239
  1. Avatar for alwen 41. alwen Lv 1 22 pts. 8,763
  2. Avatar for jeff101 42. jeff101 Lv 1 22 pts. 8,759
  3. Avatar for Fat Tony 43. Fat Tony Lv 1 21 pts. 8,754
  4. Avatar for diamonddays 44. diamonddays Lv 1 20 pts. 8,724
  5. Avatar for Tehnologik1 45. Tehnologik1 Lv 1 19 pts. 8,708
  6. Avatar for Altercomp 46. Altercomp Lv 1 18 pts. 8,708
  7. Avatar for WBarme1234 47. WBarme1234 Lv 1 17 pts. 8,670
  8. Avatar for ManVsYard 48. ManVsYard Lv 1 16 pts. 8,640
  9. Avatar for Deleted player 49. Deleted player pts. 8,639
  10. Avatar for caglar 50. caglar Lv 1 15 pts. 8,634

Comments