Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 5,622
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 5,060
  3. Avatar for Russian team 13. Russian team 1 pt. 0
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 0

  1. Avatar for Glen B 61. Glen B Lv 1 9 pts. 8,504
  2. Avatar for heather-1 62. heather-1 Lv 1 8 pts. 8,477
  3. Avatar for Sissue 63. Sissue Lv 1 8 pts. 8,475
  4. Avatar for benrh 64. benrh Lv 1 8 pts. 8,464
  5. Avatar for shacamin 65. shacamin Lv 1 7 pts. 8,418
  6. Avatar for Jim Fraser 66. Jim Fraser Lv 1 7 pts. 8,399
  7. Avatar for alcor29 67. alcor29 Lv 1 6 pts. 8,363
  8. Avatar for atlas100 69. atlas100 Lv 1 6 pts. 8,329
  9. Avatar for andrewtmaxwell 70. andrewtmaxwell Lv 1 5 pts. 8,329

Comments