Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 1 pt. 6,239
  1. Avatar for Glen B 61. Glen B Lv 1 9 pts. 8,504
  2. Avatar for heather-1 62. heather-1 Lv 1 8 pts. 8,477
  3. Avatar for Sissue 63. Sissue Lv 1 8 pts. 8,475
  4. Avatar for benrh 64. benrh Lv 1 8 pts. 8,464
  5. Avatar for shacamin 65. shacamin Lv 1 7 pts. 8,418
  6. Avatar for Jim Fraser 66. Jim Fraser Lv 1 7 pts. 8,399
  7. Avatar for alcor29 67. alcor29 Lv 1 6 pts. 8,363
  8. Avatar for Anfinsen_slept_here 68. Anfinsen_slept_here Lv 1 6 pts. 8,330
  9. Avatar for atlas100 69. atlas100 Lv 1 6 pts. 8,329
  10. Avatar for andrewtmaxwell 70. andrewtmaxwell Lv 1 5 pts. 8,329

Comments