Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,865
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,848
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,820
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,778
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,706
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,703
  7. Avatar for Contenders 7. Contenders 8 pts. 9,636
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,613
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,587
  10. Avatar for DSN @ Home 10. DSN @ Home 2 pts. 9,181
  1. Avatar for grogar7 11. grogar7 Lv 1 73 pts. 9,694
  2. Avatar for TastyMunchies 12. TastyMunchies Lv 1 70 pts. 9,680
  3. Avatar for Aubade01 13. Aubade01 Lv 1 68 pts. 9,678
  4. Avatar for reefyrob 14. reefyrob Lv 1 66 pts. 9,667
  5. Avatar for Fat Tony 15. Fat Tony Lv 1 63 pts. 9,666
  6. Avatar for Sporeo 16. Sporeo Lv 1 61 pts. 9,651
  7. Avatar for Galaxie 17. Galaxie Lv 1 59 pts. 9,648
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 57 pts. 9,636
  9. Avatar for caglar 19. caglar Lv 1 55 pts. 9,635
  10. Avatar for pauldunn 20. pauldunn Lv 1 53 pts. 9,627

Comments