Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,865
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,848
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,820
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,778
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,706
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,703
  7. Avatar for Contenders 7. Contenders 8 pts. 9,636
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,613
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,587
  10. Avatar for DSN @ Home 10. DSN @ Home 2 pts. 9,181
  1. Avatar for johnmitch 41. johnmitch Lv 1 24 pts. 9,472
  2. Avatar for isaksson 42. isaksson Lv 1 23 pts. 9,465
  3. Avatar for alwen 43. alwen Lv 1 22 pts. 9,415
  4. Avatar for sciencewalker 44. sciencewalker Lv 1 21 pts. 9,408
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 20 pts. 9,406
  6. Avatar for tarimo 46. tarimo Lv 1 19 pts. 9,392
  7. Avatar for Glen B 47. Glen B Lv 1 18 pts. 9,380
  8. Avatar for weitzen 48. weitzen Lv 1 18 pts. 9,371
  9. Avatar for Norrjane 49. Norrjane Lv 1 17 pts. 9,364
  10. Avatar for Anfinsen_slept_here 50. Anfinsen_slept_here Lv 1 16 pts. 9,358

Comments