Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary


Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Go Science 100 pts. 9,865
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,848
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,820
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,778
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,706
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,703
  7. Avatar for Contenders 7. Contenders 8 pts. 9,636
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,613
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,587
  10. Avatar for DSN @ Home 10. DSN @ Home 2 pts. 9,181

  1. Avatar for ManVsYard 121. ManVsYard Lv 1 1 pt. 8,875
  2. Avatar for RainerGewalt 122. RainerGewalt Lv 1 1 pt. 8,861
  3. Avatar for micheldeweerd 123. micheldeweerd Lv 1 1 pt. 8,858
  4. Avatar for Gahmeir 124. Gahmeir Lv 1 1 pt. 8,840
  5. Avatar for alyssa_d 125. alyssa_d Lv 1 1 pt. 8,834
  6. Avatar for nellasdim 126. nellasdim Lv 1 1 pt. 8,833
  7. Avatar for Anamfija 127. Anamfija Lv 1 1 pt. 8,831
  8. Avatar for Graham MF 128. Graham MF Lv 1 1 pt. 8,805
  9. Avatar for wuhongzei 129. wuhongzei Lv 1 1 pt. 8,801
  10. Avatar for rolfpf 130. rolfpf Lv 1 1 pt. 8,784

Comments