Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,865
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,848
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,820
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,778
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,706
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,703
  7. Avatar for Contenders 7. Contenders 8 pts. 9,636
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,613
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,587
  10. Avatar for DSN @ Home 10. DSN @ Home 2 pts. 9,181
  1. Avatar for Lord InsidiousTroll 141. Lord InsidiousTroll Lv 1 1 pt. 8,617
  2. Avatar for sekret220 142. sekret220 Lv 1 1 pt. 8,564
  3. Avatar for Petrifolder 143. Petrifolder Lv 1 1 pt. 8,304
  4. Avatar for FractalCuber 144. FractalCuber Lv 1 1 pt. 8,283
  5. Avatar for the folding falafel 145. the folding falafel Lv 1 1 pt. 8,216
  6. Avatar for 01010011111 146. 01010011111 Lv 1 1 pt. 8,206
  7. Avatar for smcclosk 147. smcclosk Lv 1 1 pt. 8,119
  8. Avatar for toshiue 148. toshiue Lv 1 1 pt. 7,906
  9. Avatar for Tehnologik1 149. Tehnologik1 Lv 1 1 pt. 7,830
  10. Avatar for joshmiller 150. joshmiller Lv 1 1 pt. 7,802

Comments