Placeholder image of a protein
Icon representing a puzzle

1489: Revisiting Puzzle 52: Bacteria Energy

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 28, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Go Science 100 pts. 9,865
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 9,848
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,820
  4. Avatar for Marvin's bunch 4. Marvin's bunch 33 pts. 9,778
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,706
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 14 pts. 9,703
  7. Avatar for Contenders 7. Contenders 8 pts. 9,636
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,613
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 9,587
  10. Avatar for DSN @ Home 10. DSN @ Home 2 pts. 9,181

  1. Avatar for sktbrd341 111. sktbrd341 Lv 1 1 pt. 8,962
  2. Avatar for Mike Cassidy 112. Mike Cassidy Lv 1 1 pt. 8,949
  3. Avatar for nofikanomusic 113. nofikanomusic Lv 1 1 pt. 8,942
  4. Avatar for dbuske 114. dbuske Lv 1 1 pt. 8,942
  5. Avatar for Knoblerine 115. Knoblerine Lv 1 1 pt. 8,941
  6. Avatar for VeeTTek 116. VeeTTek Lv 1 1 pt. 8,931
  7. Avatar for lamoille 117. lamoille Lv 1 1 pt. 8,899
  8. Avatar for NotJim99 118. NotJim99 Lv 1 1 pt. 8,884
  9. Avatar for Auntecedent 119. Auntecedent Lv 1 1 pt. 8,884
  10. Avatar for bergie72 120. bergie72 Lv 1 1 pt. 8,879

Comments