Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 70 pts. 10,027
  2. Avatar for Madde 12. Madde Lv 1 67 pts. 9,996
  3. Avatar for pvc78 13. pvc78 Lv 1 64 pts. 9,993
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 62 pts. 9,981
  5. Avatar for Aubade01 15. Aubade01 Lv 1 60 pts. 9,972
  6. Avatar for robgee 16. robgee Lv 1 57 pts. 9,963
  7. Avatar for Threeoak 17. Threeoak Lv 1 55 pts. 9,960
  8. Avatar for frood66 18. frood66 Lv 1 53 pts. 9,946
  9. Avatar for georg137 19. georg137 Lv 1 51 pts. 9,932
  10. Avatar for reefyrob 20. reefyrob Lv 1 49 pts. 9,919

Comments