Placeholder image of a protein
Icon representing a puzzle

1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,157
  2. Avatar for Beta Folders 2. Beta Folders 63 pts. 10,138
  3. Avatar for Go Science 3. Go Science 37 pts. 10,115
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,101
  5. Avatar for Void Crushers 5. Void Crushers 11 pts. 9,996
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 5 pts. 9,977
  7. Avatar for Marvin's bunch 7. Marvin's bunch 2 pts. 9,946
  8. Avatar for Contenders 8. Contenders 1 pt. 9,932
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,884
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,023

  1. Avatar for pauldunn 31. pauldunn Lv 1 30 pts. 9,825
  2. Avatar for phi16 32. phi16 Lv 1 29 pts. 9,798
  3. Avatar for Skippysk8s 33. Skippysk8s Lv 1 28 pts. 9,795
  4. Avatar for dbuske 34. dbuske Lv 1 27 pts. 9,794
  5. Avatar for Galaxie 35. Galaxie Lv 1 25 pts. 9,793
  6. Avatar for Glen B 36. Glen B Lv 1 24 pts. 9,750
  7. Avatar for Anfinsen_slept_here 37. Anfinsen_slept_here Lv 1 23 pts. 9,747
  8. Avatar for isaksson 38. isaksson Lv 1 22 pts. 9,743
  9. Avatar for alwen 39. alwen Lv 1 21 pts. 9,725
  10. Avatar for grogar7 40. grogar7 Lv 1 20 pts. 9,668

Comments