1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Summary

• Created: April 09, 2018
• Expires: April 16, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

• 1. Gargleblasters 100 pts. 10,157
• 2. Beta Folders 63 pts. 10,138
• 3. Go Science 37 pts. 10,115
• 4. L'Alliance Francophone 21 pts. 10,101
• 5. Void Crushers 11 pts. 9,996
• 6. Anthropic Dreams 5 pts. 9,977
• 7. Marvin's bunch 2 pts. 9,946
• 8. Contenders 1 pt. 9,932
• 9. HMT heritage 1 pt. 9,884
• 10. Eὕρηκα! Heureka! 1 pt. 9,023

Top soloists

• 41. TastyMunchies 19 pts. 9,656
• 42. FillmoreLove 18 pts. 9,638
• 43. hpaege 17 pts. 9,627
• 44. katling 16 pts. 9,589
• 45. Alistair69 16 pts. 9,587
• 46. hada 15 pts. 9,574
• 47. christioanchauvin 14 pts. 9,570
• 48. WBarme1234 13 pts. 9,565
• 49. guineapig 13 pts. 9,564
• 50. Pyotr 12 pts. 9,564