1506: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 8 years ago

Summary

• Created: April 09, 2018
• Expires: April 16, 2018 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

• 1. Gargleblasters 100 pts. 10,157
• 2. Beta Folders 63 pts. 10,138
• 3. Go Science 37 pts. 10,115
• 4. L'Alliance Francophone 21 pts. 10,101
• 5. Void Crushers 11 pts. 9,996
• 6. Anthropic Dreams 5 pts. 9,977
• 7. Marvin's bunch 2 pts. 9,946
• 8. Contenders 1 pt. 9,932
• 9. HMT heritage 1 pt. 9,884
• 10. Eὕρηκα! Heureka! 1 pt. 9,023

Top soloists

• 21. Bletchley Park 47 pts. 9,891
• 22. johnmitch 45 pts. 9,886
• 23. O Seki To 43 pts. 9,884
• 24. Idiotboy 41 pts. 9,876
• 25. eusair 40 pts. 9,869
• 26. erikviking 38 pts. 9,858
• 27. Vinara 36 pts. 9,857
• 28. Deleted player pts. 9,855
• 29. Blipperman 33 pts. 9,844
• 30. manu8170 32 pts. 9,841