Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for navn 91. navn Lv 1 2 pts. 8,837
  2. Avatar for ourtown 92. ourtown Lv 1 2 pts. 8,834
  3. Avatar for jamiexq 93. jamiexq Lv 1 2 pts. 8,811
  4. Avatar for Knoblerine 94. Knoblerine Lv 1 2 pts. 8,784
  5. Avatar for versat82 95. versat82 Lv 1 2 pts. 8,745
  6. Avatar for parsnip 96. parsnip Lv 1 2 pts. 8,718
  7. Avatar for Psych0Active 97. Psych0Active Lv 1 2 pts. 8,705
  8. Avatar for MicElephant 98. MicElephant Lv 1 1 pt. 8,648
  9. Avatar for dbuske 99. dbuske Lv 1 1 pt. 8,591
  10. Avatar for Luna_ 100. Luna_ Lv 1 1 pt. 8,587

Comments