Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for navn 91. navn Lv 1 2 pts. 8,837
  2. Avatar for ourtown 92. ourtown Lv 1 2 pts. 8,834
  3. Avatar for jamiexq 93. jamiexq Lv 1 2 pts. 8,811
  4. Avatar for Knoblerine 94. Knoblerine Lv 1 2 pts. 8,784
  5. Avatar for versat82 95. versat82 Lv 1 2 pts. 8,745
  6. Avatar for parsnip 96. parsnip Lv 1 2 pts. 8,718
  7. Avatar for Psych0Active 97. Psych0Active Lv 1 2 pts. 8,705
  8. Avatar for MicElephant 98. MicElephant Lv 1 1 pt. 8,648
  9. Avatar for dbuske 99. dbuske Lv 1 1 pt. 8,591
  10. Avatar for Luna_ 100. Luna_ Lv 1 1 pt. 8,587

Comments