Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for mitarcher 101. mitarcher Lv 1 1 pt. 8,565
  2. Avatar for andrewxc 102. andrewxc Lv 1 1 pt. 8,563
  3. Avatar for yoyoparis 103. yoyoparis Lv 1 1 pt. 8,496
  4. Avatar for LostLogia4 104. LostLogia4 Lv 1 1 pt. 8,472
  5. Avatar for Arne Heessels 105. Arne Heessels Lv 1 1 pt. 8,471
  6. Avatar for Deleted player 106. Deleted player pts. 8,469
  7. Avatar for kludbrook 107. kludbrook Lv 1 1 pt. 8,464
  8. Avatar for Lord_c_nu 108. Lord_c_nu Lv 1 1 pt. 8,412
  9. Avatar for crazyman4865 109. crazyman4865 Lv 1 1 pt. 8,340
  10. Avatar for katling 110. katling Lv 1 1 pt. 8,276

Comments