Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for mitarcher 101. mitarcher Lv 1 1 pt. 8,565
  2. Avatar for andrewxc 102. andrewxc Lv 1 1 pt. 8,563
  3. Avatar for yoyoparis 103. yoyoparis Lv 1 1 pt. 8,496
  4. Avatar for LostLogia4 104. LostLogia4 Lv 1 1 pt. 8,472
  5. Avatar for Arne Heessels 105. Arne Heessels Lv 1 1 pt. 8,471
  6. Avatar for Deleted player 106. Deleted player pts. 8,469
  7. Avatar for kludbrook 107. kludbrook Lv 1 1 pt. 8,464
  8. Avatar for Lord_c_nu 108. Lord_c_nu Lv 1 1 pt. 8,412
  9. Avatar for crazyman4865 109. crazyman4865 Lv 1 1 pt. 8,340
  10. Avatar for katling 110. katling Lv 1 1 pt. 8,276

Comments