Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for Scott111 121. Scott111 Lv 1 1 pt. 7,437
  2. Avatar for Felix12356 122. Felix12356 Lv 1 1 pt. 7,365
  3. Avatar for anaserra 123. anaserra Lv 1 1 pt. 7,256
  4. Avatar for Dr.Ashford 124. Dr.Ashford Lv 1 1 pt. 7,216
  5. Avatar for kmagor 125. kmagor Lv 1 1 pt. 7,015
  6. Avatar for gask09 126. gask09 Lv 1 1 pt. 6,959
  7. Avatar for Procka 127. Procka Lv 1 1 pt. 6,918
  8. Avatar for frezae 128. frezae Lv 1 1 pt. 6,831
  9. Avatar for leonoel 129. leonoel Lv 1 1 pt. 6,815
  10. Avatar for mojo1977105 130. mojo1977105 Lv 1 1 pt. 6,805

Comments