Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for Scott111 121. Scott111 Lv 1 1 pt. 7,437
  2. Avatar for Felix12356 122. Felix12356 Lv 1 1 pt. 7,365
  3. Avatar for anaserra 123. anaserra Lv 1 1 pt. 7,256
  4. Avatar for Dr.Ashford 124. Dr.Ashford Lv 1 1 pt. 7,216
  5. Avatar for kmagor 125. kmagor Lv 1 1 pt. 7,015
  6. Avatar for gask09 126. gask09 Lv 1 1 pt. 6,959
  7. Avatar for Procka 127. Procka Lv 1 1 pt. 6,918
  8. Avatar for frezae 128. frezae Lv 1 1 pt. 6,831
  9. Avatar for leonoel 129. leonoel Lv 1 1 pt. 6,815
  10. Avatar for mojo1977105 130. mojo1977105 Lv 1 1 pt. 6,805

Comments