Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for Susume 11. Susume Lv 1 73 pts. 9,888
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 71 pts. 9,853
  3. Avatar for phi16 13. phi16 Lv 1 68 pts. 9,845
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 66 pts. 9,841
  5. Avatar for frood66 15. frood66 Lv 1 64 pts. 9,841
  6. Avatar for Blipperman 16. Blipperman Lv 1 62 pts. 9,829
  7. Avatar for TastyMunchies 17. TastyMunchies Lv 1 60 pts. 9,809
  8. Avatar for tarimo 18. tarimo Lv 1 58 pts. 9,806
  9. Avatar for eusair 19. eusair Lv 1 56 pts. 9,799
  10. Avatar for AtOneMent 20. AtOneMent Lv 1 54 pts. 9,789

Comments