Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for Susume 11. Susume Lv 1 73 pts. 9,888
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 71 pts. 9,853
  3. Avatar for phi16 13. phi16 Lv 1 68 pts. 9,845
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 66 pts. 9,841
  5. Avatar for frood66 15. frood66 Lv 1 64 pts. 9,841
  6. Avatar for Blipperman 16. Blipperman Lv 1 62 pts. 9,829
  7. Avatar for TastyMunchies 17. TastyMunchies Lv 1 60 pts. 9,809
  8. Avatar for tarimo 18. tarimo Lv 1 58 pts. 9,806
  9. Avatar for eusair 19. eusair Lv 1 56 pts. 9,799
  10. Avatar for AtOneMent 20. AtOneMent Lv 1 54 pts. 9,789

Comments