Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 24 pts. 9,559
  2. Avatar for Threeoak 42. Threeoak Lv 1 23 pts. 9,555
  3. Avatar for heather-1 43. heather-1 Lv 1 22 pts. 9,524
  4. Avatar for reefyrob 44. reefyrob Lv 1 21 pts. 9,519
  5. Avatar for severin333 45. severin333 Lv 1 21 pts. 9,510
  6. Avatar for Vinara 46. Vinara Lv 1 20 pts. 9,504
  7. Avatar for boondog 47. boondog Lv 1 19 pts. 9,483
  8. Avatar for joremen 48. joremen Lv 1 18 pts. 9,468
  9. Avatar for pfirth 49. pfirth Lv 1 17 pts. 9,449
  10. Avatar for Crossed Sticks 50. Crossed Sticks Lv 1 17 pts. 9,440

Comments