Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 24 pts. 9,559
  2. Avatar for Threeoak 42. Threeoak Lv 1 23 pts. 9,555
  3. Avatar for heather-1 43. heather-1 Lv 1 22 pts. 9,524
  4. Avatar for reefyrob 44. reefyrob Lv 1 21 pts. 9,519
  5. Avatar for severin333 45. severin333 Lv 1 21 pts. 9,510
  6. Avatar for Vinara 46. Vinara Lv 1 20 pts. 9,504
  7. Avatar for boondog 47. boondog Lv 1 19 pts. 9,483
  8. Avatar for joremen 48. joremen Lv 1 18 pts. 9,468
  9. Avatar for pfirth 49. pfirth Lv 1 17 pts. 9,449
  10. Avatar for Crossed Sticks 50. Crossed Sticks Lv 1 17 pts. 9,440

Comments