Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Cannabis Crew 11. Cannabis Crew 1 pt. 8,412
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,179
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 7,767
  4. Avatar for BCC 14. BCC 1 pt. 6,831
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 0
  6. Avatar for Team China 16. Team China 1 pt. 0
  1. Avatar for Jesse Pinkman 61. Jesse Pinkman Lv 1 10 pts. 9,245
  2. Avatar for drjr 62. drjr Lv 1 10 pts. 9,238
  3. Avatar for Deleted player 63. Deleted player pts. 9,219
  4. Avatar for uihcv 64. uihcv Lv 1 9 pts. 9,183
  5. Avatar for NotJim99 65. NotJim99 Lv 1 8 pts. 9,154
  6. Avatar for YeshuaLives 66. YeshuaLives Lv 1 8 pts. 9,153
  7. Avatar for GaryForbis 67. GaryForbis Lv 1 7 pts. 9,152
  8. Avatar for alcor29 68. alcor29 Lv 1 7 pts. 9,145
  9. Avatar for Deleted player 69. Deleted player pts. 9,106
  10. Avatar for ViJay7019 70. ViJay7019 Lv 1 6 pts. 9,106

Comments