Placeholder image of a protein
Icon representing a puzzle

1525: Unsolved De-novo Freestyle 131

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TTVTRHGTTVRGVSDVFVLVIEYMWQGNSDKVKKLMEEQNNEEIREYVREMVEKNGKEFTFRNGEVHVQG

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,107
  2. Avatar for Go Science 2. Go Science 71 pts. 10,106
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,031
  4. Avatar for Void Crushers 4. Void Crushers 33 pts. 10,017
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 9,957
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,841
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,710
  8. Avatar for Contenders 8. Contenders 5 pts. 9,620
  9. Avatar for Mojo Risin' 9. Mojo Risin' 3 pts. 8,979
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 2 pts. 8,745
  1. Avatar for Jesse Pinkman 61. Jesse Pinkman Lv 1 10 pts. 9,245
  2. Avatar for drjr 62. drjr Lv 1 10 pts. 9,238
  3. Avatar for Deleted player 63. Deleted player pts. 9,219
  4. Avatar for uihcv 64. uihcv Lv 1 9 pts. 9,183
  5. Avatar for NotJim99 65. NotJim99 Lv 1 8 pts. 9,154
  6. Avatar for YeshuaLives 66. YeshuaLives Lv 1 8 pts. 9,153
  7. Avatar for GaryForbis 67. GaryForbis Lv 1 7 pts. 9,152
  8. Avatar for alcor29 68. alcor29 Lv 1 7 pts. 9,145
  9. Avatar for Deleted player 69. Deleted player pts. 9,106
  10. Avatar for ViJay7019 70. ViJay7019 Lv 1 6 pts. 9,106

Comments