Placeholder image of a protein
Icon representing a puzzle

1526: Revisiting Puzzle 67: Integrase

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 24, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 4 pts. 9,898
  2. Avatar for Team Schleswig-Holstein 12. Team Schleswig-Holstein 3 pts. 9,826
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,808
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 9,718
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 9,682
  6. Avatar for Team China 16. Team China 1 pt. 9,603
  7. Avatar for Deleted group 17. Deleted group pts. 9,517
  8. Avatar for freefolder 18. freefolder 1 pt. 9,405
  9. Avatar for 7Monkeys 19. 7Monkeys 1 pt. 9,333
  10. Avatar for Russian team 20. Russian team 1 pt. 9,236
  1. Avatar for Felix12356 141. Felix12356 Lv 1 1 pt. 8,934
  2. Avatar for 01010011111 142. 01010011111 Lv 1 1 pt. 8,931
  3. Avatar for DOCnames 143. DOCnames Lv 1 1 pt. 8,904
  4. Avatar for kukukodama 144. kukukodama Lv 1 1 pt. 8,372
  5. Avatar for Kalimo 203 145. Kalimo 203 Lv 1 1 pt. 7,745
  6. Avatar for Elcy Manoel Mendes Silva 146. Elcy Manoel Mendes Silva Lv 1 1 pt. 7,717
  7. Avatar for jflat06 147. jflat06 Lv 1 1 pt. 3,046
  8. Avatar for Ssanderr4 148. Ssanderr4 Lv 1 1 pt. 2,966
  9. Avatar for Simek 149. Simek Lv 1 1 pt. 2,966
  10. Avatar for JMStiffler 150. JMStiffler Lv 1 1 pt. 2,966

Comments