Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 4 pts. 9,289
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269
  1. Avatar for Glen B 21. Glen B Lv 1 46 pts. 10,305
  2. Avatar for crpainter 22. crpainter Lv 1 44 pts. 10,287
  3. Avatar for Timo van der Laan 23. Timo van der Laan Lv 1 42 pts. 10,249
  4. Avatar for DoctorSockrates 24. DoctorSockrates Lv 1 41 pts. 10,245
  5. Avatar for TastyMunchies 25. TastyMunchies Lv 1 39 pts. 10,238
  6. Avatar for pvc78 26. pvc78 Lv 1 37 pts. 10,229
  7. Avatar for drumpeter18yrs9yrs 27. drumpeter18yrs9yrs Lv 1 36 pts. 10,221
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 34 pts. 10,207
  9. Avatar for gdnskye 29. gdnskye Lv 1 33 pts. 10,195
  10. Avatar for smilingone 30. smilingone Lv 1 31 pts. 10,173

Comments