Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  6. Avatar for Team China 17. Team China 1 pt. 0

  1. Avatar for DOCnames 101. DOCnames Lv 1 1 pt. 8,406
  2. Avatar for multaq 102. multaq Lv 1 1 pt. 8,393
  3. Avatar for carsonfb 103. carsonfb Lv 1 1 pt. 8,385
  4. Avatar for Superphosphate 104. Superphosphate Lv 1 1 pt. 8,338
  5. Avatar for Arne Heessels 105. Arne Heessels Lv 1 1 pt. 8,337
  6. Avatar for MrErubus 106. MrErubus Lv 1 1 pt. 8,275
  7. Avatar for citric acid 107. citric acid Lv 1 1 pt. 8,131
  8. Avatar for dam_01 108. dam_01 Lv 1 1 pt. 7,975
  9. Avatar for dbuske 109. dbuske Lv 1 1 pt. 7,809
  10. Avatar for Savas 110. Savas Lv 1 1 pt. 7,800

Comments