Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269

  1. Avatar for DOCnames 101. DOCnames Lv 1 1 pt. 8,406
  2. Avatar for multaq 102. multaq Lv 1 1 pt. 8,393
  3. Avatar for carsonfb 103. carsonfb Lv 1 1 pt. 8,385
  4. Avatar for Superphosphate 104. Superphosphate Lv 1 1 pt. 8,338
  5. Avatar for Arne Heessels 105. Arne Heessels Lv 1 1 pt. 8,337
  6. Avatar for MrErubus 106. MrErubus Lv 1 1 pt. 8,275
  7. Avatar for citric acid 107. citric acid Lv 1 1 pt. 8,131
  8. Avatar for dam_01 108. dam_01 Lv 1 1 pt. 7,975
  9. Avatar for dbuske 109. dbuske Lv 1 1 pt. 7,809
  10. Avatar for Savas 110. Savas Lv 1 1 pt. 7,800

Comments