Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Mojo Risin' 11. Mojo Risin' 1 pt. 9,179
  2. Avatar for Russian team 12. Russian team 1 pt. 9,114
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,540
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 7,800
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 7,172
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,048
  7. Avatar for Team China 17. Team China 1 pt. 0
  1. Avatar for sciencewalker 61. sciencewalker Lv 1 6 pts. 9,576
  2. Avatar for isaksson 62. isaksson Lv 1 6 pts. 9,570
  3. Avatar for altejoh 63. altejoh Lv 1 6 pts. 9,562
  4. Avatar for ViJay7019 64. ViJay7019 Lv 1 5 pts. 9,494
  5. Avatar for ourtown 65. ourtown Lv 1 5 pts. 9,452
  6. Avatar for silent gene 66. silent gene Lv 1 5 pts. 9,437
  7. Avatar for weitzen 67. weitzen Lv 1 4 pts. 9,397
  8. Avatar for Petrifolder 68. Petrifolder Lv 1 4 pts. 9,381
  9. Avatar for yoyoparis 69. yoyoparis Lv 1 4 pts. 9,357
  10. Avatar for pfirth 70. pfirth Lv 1 4 pts. 9,311

Comments