Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269

  1. Avatar for sciencewalker 61. sciencewalker Lv 1 6 pts. 9,576
  2. Avatar for isaksson 62. isaksson Lv 1 6 pts. 9,570
  3. Avatar for altejoh 63. altejoh Lv 1 6 pts. 9,562
  4. Avatar for ViJay7019 64. ViJay7019 Lv 1 5 pts. 9,494
  5. Avatar for ourtown 65. ourtown Lv 1 5 pts. 9,452
  6. Avatar for silent gene 66. silent gene Lv 1 5 pts. 9,437
  7. Avatar for weitzen 67. weitzen Lv 1 4 pts. 9,397
  8. Avatar for Petrifolder 68. Petrifolder Lv 1 4 pts. 9,381
  9. Avatar for yoyoparis 69. yoyoparis Lv 1 4 pts. 9,357
  10. Avatar for pfirth 70. pfirth Lv 1 4 pts. 9,311

Comments