Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary


Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269

  1. Avatar for gstelle 111. gstelle Lv 1 1 pt. 7,692
  2. Avatar for Crossed Sticks 112. Crossed Sticks Lv 1 1 pt. 7,374
  3. Avatar for nathanmills 113. nathanmills Lv 1 1 pt. 7,172
  4. Avatar for rezaefar 114. rezaefar Lv 1 1 pt. 7,070
  5. Avatar for tarimo 115. tarimo Lv 1 1 pt. 6,973
  6. Avatar for tedrich 116. tedrich Lv 1 1 pt. 6,873
  7. Avatar for 01010011111 117. 01010011111 Lv 1 1 pt. 6,564
  8. Avatar for jakestorm777 118. jakestorm777 Lv 1 1 pt. 6,410
  9. Avatar for larry25427 119. larry25427 Lv 1 1 pt. 6,186
  10. Avatar for Areazil 120. Areazil Lv 1 1 pt. 6,170

Comments