Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 4 pts. 9,289
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269
  1. Avatar for Deleted player 91. Deleted player pts. 8,682
  2. Avatar for NotJim99 92. NotJim99 Lv 1 1 pt. 8,673
  3. Avatar for mitarcher 93. mitarcher Lv 1 1 pt. 8,606
  4. Avatar for jamiexq 94. jamiexq Lv 1 1 pt. 8,573
  5. Avatar for martinf 95. martinf Lv 1 1 pt. 8,562
  6. Avatar for Sunet 96. Sunet Lv 1 1 pt. 8,550
  7. Avatar for alyssa_d 97. alyssa_d Lv 1 1 pt. 8,540
  8. Avatar for justintwayland 98. justintwayland Lv 1 1 pt. 8,504
  9. Avatar for Felix12356 99. Felix12356 Lv 1 1 pt. 8,468
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 8,450

Comments