Placeholder image of a protein
Icon representing a puzzle

1528: Unsolved De-novo Freestyle 132

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SHLEEVMEWMIREWKKGRHKEELMKWVEEYMKKQDSNSRVEIDRDNNLIRVVLSKVDIEVLFDLDNHQIQIHSKEEREKRRLEEQLKRWT

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,760
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,593
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,578
  4. Avatar for Go Science 4. Go Science 36 pts. 10,566
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,496
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 10,353
  7. Avatar for Contenders 7. Contenders 10 pts. 10,287
  8. Avatar for Void Crushers 8. Void Crushers 6 pts. 10,249
  9. Avatar for Team Schleswig-Holstein 9. Team Schleswig-Holstein 4 pts. 9,289
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,269
  1. Avatar for Vinara 51. Vinara Lv 1 11 pts. 9,753
  2. Avatar for manu8170 52. manu8170 Lv 1 10 pts. 9,711
  3. Avatar for Deleted player 53. Deleted player pts. 9,699
  4. Avatar for alwen 54. alwen Lv 1 9 pts. 9,687
  5. Avatar for jobo0502 55. jobo0502 Lv 1 9 pts. 9,646
  6. Avatar for severin333 56. severin333 Lv 1 8 pts. 9,625
  7. Avatar for MicElephant 57. MicElephant Lv 1 8 pts. 9,612
  8. Avatar for WBarme1234 58. WBarme1234 Lv 1 7 pts. 9,612
  9. Avatar for toshiue 59. toshiue Lv 1 7 pts. 9,590
  10. Avatar for Jesse Pinkman 60. Jesse Pinkman Lv 1 7 pts. 9,584

Comments