Placeholder image of a protein
Icon representing a puzzle

1532: Revisiting Puzzle 69: Scorpion Toxin

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 11, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,302
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,242
  3. Avatar for Deleted group 13. Deleted group pts. 9,060
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,008
  5. Avatar for freefolder 15. freefolder 1 pt. 8,776
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 8,758
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,731
  1. Avatar for Anamfija 111. Anamfija Lv 1 1 pt. 8,884
  2. Avatar for Museka 112. Museka Lv 1 1 pt. 8,862
  3. Avatar for momadoc 113. momadoc Lv 1 1 pt. 8,834
  4. Avatar for Mizraim 114. Mizraim Lv 1 1 pt. 8,796
  5. Avatar for Altercomp 115. Altercomp Lv 1 1 pt. 8,776
  6. Avatar for JellyJump 116. JellyJump Lv 1 1 pt. 8,771
  7. Avatar for Bithalbierer 117. Bithalbierer Lv 1 1 pt. 8,758
  8. Avatar for Psych0Active 118. Psych0Active Lv 1 1 pt. 8,745
  9. Avatar for doctaven 119. doctaven Lv 1 1 pt. 8,731
  10. Avatar for dudegirl3 120. dudegirl3 Lv 1 1 pt. 8,724

Comments