Placeholder image of a protein
Icon representing a puzzle

1534: Unsolved De-novo Freestyle 134

Closed since almost 8 years ago

Intermediate Overall Prediction

Summary

Created
June 13, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TVRIELEGVDEEIRQWVRELLREVLEKEGGEIELDLQDGHIEIRLENITEERLRELQEKIKKYVENKGGRVEIRE

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,123
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,863
  3. Avatar for Team South Africa 13. Team South Africa 1 pt. 6,608
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 5,702
  5. Avatar for Deleted group 15. Deleted group pts. 5,627
  1. Avatar for Deleted player 51. Deleted player pts. 9,885
  2. Avatar for khalan.ysatis 52. khalan.ysatis Lv 1 9 pts. 9,845
  3. Avatar for jausmh 53. jausmh Lv 1 9 pts. 9,844
  4. Avatar for drumpeter18yrs9yrs 54. drumpeter18yrs9yrs Lv 1 8 pts. 9,815
  5. Avatar for YeshuaLives 55. YeshuaLives Lv 1 8 pts. 9,814
  6. Avatar for Deleted player 56. Deleted player pts. 9,771
  7. Avatar for TastyMunchies 57. TastyMunchies Lv 1 7 pts. 9,750
  8. Avatar for katling 58. katling Lv 1 7 pts. 9,731
  9. Avatar for andrewtmaxwell 59. andrewtmaxwell Lv 1 6 pts. 9,729
  10. Avatar for joaniegirl 60. joaniegirl Lv 1 6 pts. 9,691

Comments